A database of hormones and their receptors |
|
|
|
|
|
|
HMRbase accession number | 10257 |
Swiss-prot Accession number | P31297 (Sequence in FASTA format) |
Description | Glucagon. |
Source organism | Chinchilla brevicaudata (Chinchilla) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia;Hystricognathi; Chinchillidae; Chinchilla. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the glucagon family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Glucagon plays a key role in glucose metabolism and homeostasis. Regulates blood glucose by increasing gluconeogenesis and decreasing glycolysis |
Protein Length | 29 Amino acids |
Molecular weight | 3478 |
References | 1 PubMed abstract 2235678 |
Domain Name | Hormone_2 |
Hormone Name | Glucagon |
Mature Hormone Sequence | HSQGTFTSDYSKHLDSRYAQEFVQWLMNT |
Position of mature hormone in Pre-Hormone protein | 29 Residues from position (1-29) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 10431 |
Swiss-prot Accession number | P10034 (Sequence in FASTA format) |
Description | Gastrin precursor [Contains: Big gastrin (Gastrin 33) (G33); Gastrin]. |
Source organism | Chinchilla brevicaudata (Chinchilla) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia;Hystricognathi; Chinchillidae; Chinchilla. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the gastrin/cholecystokinin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Gastrin stimulates the stomach mucosa to produce and secrete hydrochloric acid and the pancreas to secrete its digestive enzymes. It also stimulates smooth muscle contraction and increases blood circulation and water secretion in the stomach and intestine |
Protein Length | 33 Amino acids |
Molecular weight | 3715 |
References | 1 PubMed abstract 3827930 |
Domain Name | N/A |
Hormone Name | Big gastrin |
Mature Hormone Sequence | ELEPQGPPHLGTDLSKKQGPWAEEEAAYGWMDF |
Position of mature hormone in Pre-Hormone protein | 33 Residues from position (1-33) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 10432 |
Swiss-prot Accession number | P10034 (Sequence in FASTA format) |
Description | Gastrin precursor [Contains: Big gastrin (Gastrin 33) (G33); Gastrin]. |
Source organism | Chinchilla brevicaudata (Chinchilla) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia;Hystricognathi; Chinchillidae; Chinchilla. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the gastrin/cholecystokinin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Gastrin stimulates the stomach mucosa to produce and secrete hydrochloric acid and the pancreas to secrete its digestive enzymes. It also stimulates smooth muscle contraction and increases blood circulation and water secretion in the stomach and intestine |
Protein Length | 33 Amino acids |
Molecular weight | 3715 |
References | 1 PubMed abstract 3827930 |
Domain Name | N/A |
Hormone Name | Gastrin |
Mature Hormone Sequence | QGPWAEEEAAYGWMDF |
Position of mature hormone in Pre-Hormone protein | 16 Residues from position (18-33) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 10674 |
Swiss-prot Accession number | P41519 (Sequence in FASTA format) |
Description | Pancreatic hormone (Pancreatic polypeptide) (PP). |
Source organism | Chinchilla brevicaudata (Chinchilla) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia;Hystricognathi; Chinchillidae; Chinchilla. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | Belongs to the NPY family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Pancreatic hormone is synthesized in pancreatic islets of Langerhans and acts as a regulator of pancreatic and gastrointestinal functions |
Protein Length | 36 Amino acids |
Molecular weight | 4215 |
References | 1 PubMed abstract 2235678 |
Domain Name | Hormone_3 |
Hormone Name | Pancreatic hormone |
Mature Hormone Sequence | APLEPVYPGDNATPEQMAQYAAEMRRYINMLTRPRY |
Position of mature hormone in Pre-Hormone protein | 36 Residues from position (1-36) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 10816 |
Swiss-prot Accession number | P01327 (Sequence in FASTA format) |
Description | Insulin precursor [Contains: Insulin B chain; Insulin A chain]. |
Source organism | Chinchilla brevicaudata (Chinchilla) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia;Hystricognathi; Chinchillidae; Chinchilla. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the insulin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver |
Protein Length | 86 Amino acids |
Molecular weight | 9470 |
References | 1 PubMed abstract 1175610 2 PubMed abstract 808541 |
Domain Name | Insulin |
Hormone Name | Insulin B chain |
Mature Hormone Sequence | FVNKHLCGSHLVDALYLVCGDRGFFYTPMA |
Position of mature hormone in Pre-Hormone protein | 30 Residues from position (1-30) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 10817 |
Swiss-prot Accession number | P01327 (Sequence in FASTA format) |
Description | Insulin precursor [Contains: Insulin B chain; Insulin A chain]. |
Source organism | Chinchilla brevicaudata (Chinchilla) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia;Hystricognathi; Chinchillidae; Chinchilla. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the insulin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver |
Protein Length | 86 Amino acids |
Molecular weight | 9470 |
References | 1 PubMed abstract 1175610 2 PubMed abstract 808541 |
Domain Name | Insulin |
Hormone Name | Insulin A chain |
Mature Hormone Sequence | GIVDQCCTSICTLYQLENYCN |
Position of mature hormone in Pre-Hormone protein | 21 Residues from position (66-86) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |