A database of hormones and their receptors

Home

Hormone Peptide Non-peptide Search Search Browse Browse H-R Pair H-R Pair

Receptor Search Browse

Tools BLAST Domain Search Peptide Mapping Structure Search

Miscellaneous Online Submission HMRbase Information Supplementary Information Recent Information Help

Contact

Peptide Hormone

Search Result - 1

HMRbase accession number	10257
Swiss-prot Accession number	P31297 (Sequence in FASTA format)
Description	Glucagon.
Source organism	Chinchilla brevicaudata (Chinchilla)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia;Hystricognathi; Chinchillidae; Chinchilla.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the glucagon family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Glucagon plays a key role in glucose metabolism and homeostasis. Regulates blood glucose by increasing gluconeogenesis and decreasing glycolysis
Protein Length	29 Amino acids
Molecular weight	3478
References	1  PubMed abstract 2235678
Domain Name	Hormone_2
Hormone Name	Glucagon
Mature Hormone Sequence	HSQGTFTSDYSKHLDSRYAQEFVQWLMNT
Position of mature hormone in Pre-Hormone protein	29 Residues from position (1-29)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 2

HMRbase accession number	10431
Swiss-prot Accession number	P10034 (Sequence in FASTA format)
Description	Gastrin precursor [Contains: Big gastrin (Gastrin 33) (G33); Gastrin].
Source organism	Chinchilla brevicaudata (Chinchilla)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia;Hystricognathi; Chinchillidae; Chinchilla.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the gastrin/cholecystokinin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Gastrin stimulates the stomach mucosa to produce and secrete hydrochloric acid and the pancreas to secrete its digestive enzymes. It also stimulates smooth muscle contraction and increases blood circulation and water secretion in the stomach and intestine
Protein Length	33 Amino acids
Molecular weight	3715
References	1  PubMed abstract 3827930
Domain Name	N/A
Hormone Name	Big gastrin
Mature Hormone Sequence	ELEPQGPPHLGTDLSKKQGPWAEEEAAYGWMDF
Position of mature hormone in Pre-Hormone protein	33 Residues from position (1-33)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 3

HMRbase accession number	10432
Swiss-prot Accession number	P10034 (Sequence in FASTA format)
Description	Gastrin precursor [Contains: Big gastrin (Gastrin 33) (G33); Gastrin].
Source organism	Chinchilla brevicaudata (Chinchilla)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia;Hystricognathi; Chinchillidae; Chinchilla.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the gastrin/cholecystokinin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Gastrin stimulates the stomach mucosa to produce and secrete hydrochloric acid and the pancreas to secrete its digestive enzymes. It also stimulates smooth muscle contraction and increases blood circulation and water secretion in the stomach and intestine
Protein Length	33 Amino acids
Molecular weight	3715
References	1  PubMed abstract 3827930
Domain Name	N/A
Hormone Name	Gastrin
Mature Hormone Sequence	QGPWAEEEAAYGWMDF
Position of mature hormone in Pre-Hormone protein	16 Residues from position (18-33)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 4

HMRbase accession number	10674
Swiss-prot Accession number	P41519 (Sequence in FASTA format)
Description	Pancreatic hormone (Pancreatic polypeptide) (PP).
Source organism	Chinchilla brevicaudata (Chinchilla)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia;Hystricognathi; Chinchillidae; Chinchilla.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the NPY family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Pancreatic hormone is synthesized in pancreatic islets of Langerhans and acts as a regulator of pancreatic and gastrointestinal functions
Protein Length	36 Amino acids
Molecular weight	4215
References	1  PubMed abstract 2235678
Domain Name	Hormone_3
Hormone Name	Pancreatic hormone
Mature Hormone Sequence	APLEPVYPGDNATPEQMAQYAAEMRRYINMLTRPRY
Position of mature hormone in Pre-Hormone protein	36 Residues from position (1-36)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 5

HMRbase accession number	10816
Swiss-prot Accession number	P01327 (Sequence in FASTA format)
Description	Insulin precursor [Contains: Insulin B chain; Insulin A chain].
Source organism	Chinchilla brevicaudata (Chinchilla)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia;Hystricognathi; Chinchillidae; Chinchilla.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	86 Amino acids
Molecular weight	9470
References	1  PubMed abstract 1175610 2  PubMed abstract 808541
Domain Name	Insulin
Hormone Name	Insulin B chain
Mature Hormone Sequence	FVNKHLCGSHLVDALYLVCGDRGFFYTPMA
Position of mature hormone in Pre-Hormone protein	30 Residues from position (1-30)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 6

HMRbase accession number	10817
Swiss-prot Accession number	P01327 (Sequence in FASTA format)
Description	Insulin precursor [Contains: Insulin B chain; Insulin A chain].
Source organism	Chinchilla brevicaudata (Chinchilla)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia;Hystricognathi; Chinchillidae; Chinchilla.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	86 Amino acids
Molecular weight	9470
References	1  PubMed abstract 1175610 2  PubMed abstract 808541
Domain Name	Insulin
Hormone Name	Insulin A chain
Mature Hormone Sequence	GIVDQCCTSICTLYQLENYCN
Position of mature hormone in Pre-Hormone protein	21 Residues from position (66-86)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated